PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG016667.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GATA
Protein Properties Length: 358aa    MW: 39338.3 Da    PI: 6.5969
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG016667.2genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA551.1e-17258291134
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                  C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  CCG016667.2 258 CMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 291
                  99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169924.6E-735341IPR016679Transcription factor, GATA, plant
SMARTSM004013.8E-16252302IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.609252288IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.65E-15256315No hitNo description
Gene3DG3DSA:3.30.50.101.0E-14256289IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.17E-14257304No hitNo description
PROSITE patternPS003440258283IPR000679Zinc finger, GATA-type
PfamPF003202.5E-15258291IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MIGQTNTTSN FMDEIDCGSF FEHIDDLLEF PSDDVDATLP DCTTTNNHTS CFVNNDDNSF  60
PGIWPTQSDS LPGSASDLSA ELSVPYEDIV QLEWLSNFVE DSFSGGSLTM KKEESTIVNN  120
KDSPPHHQYQ FQTSSPVSVL ESSSSCSGEK TAPRSPEVGA SGKRGRPRSK RPRPATFTPR  180
PAMQLISPTS SITEVPQPFD PSKIALDSEN FAESRLVIKI PNHVDPEHKK KKKIKFTVPL  240
GPVEMNQNPS PQQAVRKCMH CEITKTPQWR AGPMGPKTLC NACGVRYKSG RLFPEYRPAA  300
SPTFVPSLHS NSHKKVVEMR AKAGEKITVS RPAAMVANSP ELIPNKSNPA MDYIEGMV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1169173KRPRP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9707790.0AB970779.1 Populus nigra PniGATA8b mRNA for GATA type zinc finger domain, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011031733.10.0PREDICTED: GATA transcription factor 8-like
TrEMBLB9HLK60.0B9HLK6_POPTR; Zinc finger family protein
STRINGPOPTR_0008s03880.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48873356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.23e-43GATA family protein